PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00747.1.g00320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 128aa    MW: 13840.6 Da    PI: 8.4952
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00747.1.g00320.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind77.72e-241472260
                                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
                  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                                  Fl+k+ye+++d++++ ++ w+  g+sfvv ++ ef +++LpkyFkh+nf+SFvRQLn+Y
  Zmw_sc00747.1.g00320.1.sm.mk 14 FLSKTYEMVDDPATDAVVAWTPPGTSFVVANQAEFCRDLLPKYFKHNNFSSFVRQLNTY 72
                                  9********************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.103.2E-27976IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.09E-23978IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.2E-281098IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.3E-211476IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.1E-171437IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.1E-175264IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.1E-176577IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MEGGGGGGSS LPPFLSKTYE MVDDPATDAV VAWTPPGTSF VVANQAEFCR DLLPKYFKHN  60
NFSSFVRQLN TYVSERHPSP LATFVAHRTR FLGRVSAADF IGAWALGKLT QSNGSLQMRI  120
SLGDNGTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B2e-234721987Heat shock factor protein 1
5d5v_B2e-234721987Heat shock factor protein 1
5d5v_D2e-234721987Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456359.14e-44hypothetical protein SORBIDRAFT_03g034630
TrEMBLC5XK404e-44C5XK40_SORBI; Putative uncharacterized protein Sb03g034630
STRINGSb03g034630.11e-43(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394